PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010088815.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Moraceae; Morus
Family MYB
Protein Properties Length: 244aa    MW: 27029.4 Da    PI: 8.4429
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010088815.1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding26.61.4e-082166447
                     S-HHHHHHHHHHHHHTTTT...-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  4 WTteEdellvdavkqlGgg...tWktIartmgkgRtlkqcksrwqky 47
                     WT eEd+l+ +a    + g   +W+ Ia +++ g+++ ++  +++++
   XP_010088815.1 21 WTREEDKLFEQALVSIPDGapdRWAMIALRLP-GKSAADVAMHYHDL 66
                     ********************************.***********976 PP

2Myb_DNA-binding48.52e-15120164347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +WT++E++l++++ +q+G+g+W++I+r +  +Rt+ q+ s+ qky
   XP_010088815.1 120 PWTEQEHKLFLKGLQQYGKGDWRSISRNVVITRTPTQVASHAQKY 164
                      8*****************************99************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM007178.2E-71769IPR001005SANT/Myb domain
SuperFamilySSF466891.65E-101971IPR009057Homeodomain-like
PROSITE profilePS500906.8062167IPR017877Myb-like domain
Gene3DG3DSA:1.10.10.608.5E-52166IPR009057Homeodomain-like
CDDcd001671.03E-62167No hitNo description
PfamPF002497.3E-72166IPR001005SANT/Myb domain
PROSITE profilePS5129418.702113169IPR017930Myb domain
SuperFamilySSF466893.88E-16115168IPR009057Homeodomain-like
TIGRFAMsTIGR015578.6E-17116168IPR006447Myb domain, plants
SMARTSM007174.8E-13117167IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.605.5E-12117162IPR009057Homeodomain-like
CDDcd001672.28E-11120164No hitNo description
PfamPF002499.0E-14120164IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 244 aa     Download sequence    Send to blast
MFQDDPCWAL GVSTQSASTG WTREEDKLFE QALVSIPDGA PDRWAMIALR LPGKSAADVA  60
MHYHDLVHDV GEIDAGRVEL PSYADDSALS PRRGGWDSAN QISFGVAKPK QEPERKKGTP  120
WTEQEHKLFL KGLQQYGKGD WRSISRNVVI TRTPTQVASH AQKYYIRQGA AKKERKRSSI  180
HDITTVDSNA VHAAPSADQK NFIQPPAANP PPQQMPMLMN HPQAQSLMPN QGGPLGYQTY  240
GFPM
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00055PBMTransfer from AT5G04760Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010088815.10.0Transcription factor
TrEMBLW9R2H40.0W9R2H4_9R
STRINGGLYMA20G24600.13e-88(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF60683251
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G04760.14e-71MYB family protein